PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G14240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 665aa    MW: 73591.9 Da    PI: 8.5505
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G14240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM100.52.4e-31331612128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       +G+ F+Pt+ elvv+yL +++ +++l++ ++i++vdi  ++Pwd+     ++++  +fF++++++++++ ++n a+ +g+W+  g++ ++++k
  OGLUM11G14240.1  33 SVGCVFRPTEGELVVNYLYRRAMQEPLPC-DFITDVDIQCHNPWDIV--PGEKKNGKHFFTRKENSHPRDYESNHAAGDGFWRLAGTEVPIYNK 123
                      68***************************.99**************5..34566799************************************* PP

              NAM  96 .....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++lvg+k+tLvf+  +++++e+t Wvm+e+rl
  OGLUM11G14240.1 124 psggaDEKLVGMKRTLVFHFRKSSSTERTGWVMQEFRL 161
                      999988889**********9999*************98 PP

2NAM97.81.6e-304035288128
              NAM   8 hPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                      hPt+ elv +yL +++ + +l   e+i +v+i++++Pwd+   +++++ek  yfF++++ k ++++r+nr+t++g+W++ g++k+v+ +  +  
  OGLUM11G14240.1 403 HPTEGELVFHYLYRRAVNMPLLS-EFICDVNILRHNPWDIVpGALTEREKGKYFFMQKEIKCPSSRRSNRITSKGFWRSAGSEKPVYYNqgG-- 493
                      9*******************777.89**************54788889999************************************98551.. PP

              NAM  99 l.....vglkktLvfykgrapkgektdWvmheyrl 128
                            vg+++tL+fy g+++++e+t+W m+e+rl
  OGLUM11G14240.1 494 GsdcmlVGMRRTLTFYFGNSRTAERTKWGMQEFRL 528
                      234566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-3329171IPR003441NAC domain
PROSITE profilePS5100532.7432227IPR003441NAC domain
PfamPF023659.6E-1734161IPR003441NAC domain
SuperFamilySSF1019414.45E-33215226IPR003441NAC domain
SuperFamilySSF1019414.84E-34396538IPR003441NAC domain
PROSITE profilePS5100533.046396597IPR003441NAC domain
PfamPF023654.4E-15403528IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MRRICPRFKI NGRTMAGPGV CINLLNGTTM HLSVGCVFRP TEGELVVNYL YRRAMQEPLP  60
CDFITDVDIQ CHNPWDIVPG EKKNGKHFFT RKENSHPRDY ESNHAAGDGF WRLAGTEVPI  120
YNKPSGGADE KLVGMKRTLV FHFRKSSSTE RTGWVMQEFR LAGASLVPCL VMRPATGDVS  180
MPPCGCTETT TTKKNNGSPS AAHTHAPLVE TMVEPDNSWM ICRIYKKRQR APQVIIPPSI  240
GNAREAVLAV PAIGNAGDRQ VNFIDFPGHR CFEEGSDESA NVITKDKGSD ARQEKKNGKH  300
FFTCKEKKHH GNNCRNHAAG VGFWRLASTE ALEVFICREH GMSNARVPTS WFLPLALLCD  360
ATISPSFEEG SSESVNVTDN VKDGGGHCMN GATMHLPAVG MSHPTEGELV FHYLYRRAVN  420
MPLLSEFICD VNILRHNPWD IVPGALTERE KGKYFFMQKE IKCPSSRRSN RITSKGFWRS  480
AGSEKPVYYN QGGGSDCMLV GMRRTLTFYF GNSRTAERTK WGMQEFRLAG NGLSPYPAMK  540
HATGDGSKPP CNCAETTIAK RNDGLSAVLR NVLAVTPLVE TVVEPDGSWL ICRIYRTRQR  600
ALPVITPPAI ENAREIIIPP ANGNAREAQV RFIDFLRQGS HCSCIVGPSL AEGSDESAGS  660
VDQKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-193052811140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9401960.0FJ940196.1 Oryza sativa Japonica Group clone KCS246C06 NAM protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616648.11e-118PREDICTED: NAC transcription factor NAM-1
TrEMBLA0A0E0BJF00.0A0A0E0BJF0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA035332-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-26NAC domain containing protein 83